Physiologically active peptide design services

We offer physiologically active peptide design services including lead sequence, symmetric algorithm and the Protein & Hit Method (PH Method).

The principle of the PH Method
Analyses by our proprietary PH Method will identify peptide symmetry. We have found that a peptide’s symmetric properties correlate with peptide physiological activity.

In the PH Method, the elements of symmetry consist of the following three types:

  1. N-terminal end symmetry
  2. C-terminal end symmetry
  3. Amino acid sequence symmetry

The PH Method predicts that activity level can be higher in the absence of breaks in these three types of symmetry.

Here we explain the correlation between peptide symmetry and physiological activity using angiotensin as an example.

Angiotensin I:
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
Angiotensin II:
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH
Angiotensin III:
Arg-Val-Tyr-Ile-His-Pro-Phe-OH

1. Angiotensin I is understood to have no effect on increasing blood pressure.
The PH Method algorithm identifies a symmetry break at His-Leu at the C-terminal end.

2. Angiotensin II is understood to have a more potent hypertensive effect than the other two peptides. The PH Method algorithm finds symmetry at both the N-terminal end and C-terminal end.

3. Angiotensin III is understood to have lower activity than angiotensin II.
The PH Method identifies a symmetry break at Ile, the 4th residue from the N-terminal end in the sequence of Arg-Val-Tyr-Ile-His-Pro-Phe-OH.
In this case, there is a symmetry break in the amino acid sequence in Arg-Val-Tyr and Ile-His-Pro-Phe-OH.
Such cases may result in multiple activities or lower activities.

For a design example employing the PH Method, these three residues, Arg-Val-Tyr, can be redesigned as a lead sequence, and then the sequence can be Arg-Val-Tyr-Met-Phe-Phe-Tyr-Phe-OH.
Then, the sequence can be estimated as a physiologically active peptide.

Peptide design by the PH Method will ensure symmetry in three types of sequences, N-terminal end, C-terminal end, and amino acid sequence.

Also we assume glucagon with unknown sequence (HSQGTFTSDYSKYLDSRRAQDFVQWLMNT), and if 6 residues HSQGTF constitute the lead sequence, we can design symmetrical sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNT.
Our service can also design sequences HSQGTFTSDYSK which have fewer symmetry breaks.



This part explains the practical approach of our peptide designs by taking vasopressin as an example.
Our peptide design service will take the following steps, depending on the requests.

[Arg8] - Vasopressin (AVP)
CYFQNCPRG - NH2 (Disulfide bridge: 1 - 6)

When the peptide is designed with the lead sequence of CYFQN, the amino acid on the 6th residue should be only either “C” or “A”. The sequence will be either CYFQNC or CYFQNA. The selection of an amino acid other than “A” or “C” for the 6th residue leads to peptide sequence symmetry breaks. This makes it impossible to repair the symmetry break with peptide designing by any type of sequencing for the 7th and subsequent residues. As such, sequence analysis using PH Japan’s equation can clearly identify the types of amino acids with sequence symmetry and ones without symmetry.

Based on the sequence of CYFQNC, several amino acids can be candidates for the 7th residue. Our service has succeeded in designing a total of about 10 types of peptides up to CYFQNCXXXXX including vasopressin CYFQNCPRG. These peptides have the sequence of CYFQNC (cyclized sequence) like vasopressin, and the physiological activities of those peptides can be estimated from the level of activity of vasopressin.

When selecting “A” for the 6th residue or specifically when designing a sequence with CYFQNA, there are some candidates including CYFQNACAH. The fact that the 7th residue is “C” along with some other reasons may suggest that the type of physiological activity of this peptide might be unpredictable from vasopressin. So far, unexceptionally most of the known physiologically active peptides have symmetry as proven by our equation. This raises the expectation that our service can propose physiologically active peptide candidates with pinpoint precision.

Search Service for Physiologically Active Peptides

We will provide an estimate for our search service tailored to your request, for the following 100 residues, for example:
By request, for example, we will analyze peptides by segmenting the 8 aminoacid residues as illustrated above to identify the sequence deduced as physiologically active peptides for reporting.
100残基

ページの先頭へ